PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 999aa    MW: 107625 Da    PI: 7.5757
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017804.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.6e-08574612444
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      W+  E  ++++a++++G + +++I+ ++g +++  qck ++
       Do017804.1 574 WSNKERCRFIQAIEKHGLD-FASISVHVG-TKSIQQCKKFL 612
                      999**************99.*********.********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.624376427IPR017884SANT domain
SMARTSM007173.2377425IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-6382424IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-4565611IPR009057Homeodomain-like
PROSITE profilePS5129310.686569620IPR017884SANT domain
SMARTSM007173.4E-6570618IPR001005SANT/Myb domain
SuperFamilySSF466893.66E-7572611IPR009057Homeodomain-like
CDDcd001672.13E-6574611No hitNo description
PfamPF002495.5E-7574611IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MYVGPTWLPQ PQGTRVSSEG RRSLSSPGQL RGRDVGRDGG KGLLGPGDPS SQSAETACLP  60
PKERAEFKSP ELHSPHGNGA DDNSSEPPAE KPLDPQEETP NPPPEVLSTK TGLGSHHVTT  120
TAVSAPRPLK SSDVDVSMTQ RNHQGDVLGL GGYIEKKMSL LPKTSLADVE EEVQINRKKT  180
RLGWGQGLAK HEKQLKEQNA QKLVADGDNG EPGSSSTSKN KTLVCTATVP ASPDGPSPPP  240
GSNVDLGNNS KNMTEMLASH VGAPASSQGC TPPTGDIGYQ GNSSASLTET VICPAEVPDL  300
SGKHIPQPGN QISSMTKTVG GNCDPYNSSS GMTEMVISEL ASSHGDVIRH EMAATLNRQR  360
GVFFFEEPQT YELQGSRFKA RSQQEKDVFS EKITTFGMDF IIISSFLKNK TPTDCIDYYS  420
KHYRSECSKK ANTCLPTMKQ SQEKCKNVND AAPYMSGIAT VTATKNYTRM KTVADDIKKP  480
DQMCHQFTAH VQSPSLPDKG HHGESSMDEN GHVTGNVLVG EMNAPSLLGM NSPIINSGQA  540
VRLNIPKTVV AELKNLNEDS CCNEETRKGE QEIWSNKERC RFIQAIEKHG LDFASISVHV  600
GTKSIQQCKK FLGKCKNDLN TAMYVNSNTN STIDHRDGKI YQAGGSSGQG TSERMSLPGS  660
CRWKIPNGTI ERNQISSGKE DYETCAASEE SLDNDNRPEA FMDLTEPRQN TDSAEIREHE  720
SGIRARADDV THVQKIHQSG TTLPETTHQP TNQPDCIIFF GQVIYQDPSS GTNLSSSQGN  780
QTVGNSRGIP LPSNTVVPVR ARGGHIYPSG PSIWRTPSSG TNLSSSQGNQ IVAHSRGMPS  840
NTVIPVRARG GQVHPSGPSI WRSAPFNPGQ QALLSNTMMP YGSTNGAAVG PPLRPGSSAL  900
VNMIQQRQHV HMTSYSMIRG GEPYYLRPGS SSSGGLVNFN DFNPGQQQWS SSILDTSRMV  960
IAYPACLPGS NRNQAPTPPT AMIRPSRINR EGASTSNTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2099133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-07MYB family protein